PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009587307.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 360aa    MW: 41248.4 Da    PI: 6.353
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009587307.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.51e-56231491128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdee++++yL++kv +k++++  +++evd++k+ePwdLp+k+k +ekewyfF +rd+ky+tg r+nrat+sgyWkatgkdke++++
  XP_009587307.1  23 LPPGFRFHPTDEEIITCYLREKVMDKRFTA-IAVAEVDLNKSEPWDLPAKAKMGEKEWYFFWQRDRKYPTGMRTNRATESGYWKATGKDKEIYKS 116
                     79*************************999.88***************99999****************************************** PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     kg lvg+kktLvfykgrapkgekt+Wvmheyrl
  XP_009587307.1 117 KGCLVGMKKTLVFYKGRAPKGEKTNWVMHEYRL 149
                     *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6322174IPR003441NAC domain
PROSITE profilePS5100559.74723174IPR003441NAC domain
PfamPF023657.2E-2924149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGTCMQVINE EADLHRDDIL DQLPPGFRFH PTDEEIITCY LREKVMDKRF TAIAVAEVDL  60
NKSEPWDLPA KAKMGEKEWY FFWQRDRKYP TGMRTNRATE SGYWKATGKD KEIYKSKGCL  120
VGMKKTLVFY KGRAPKGEKT NWVMHEYRLQ GNLSYNCLHK AAMDEWVICR VFHKKIGVGR  180
GPLFVEDLLD SPSSLPCLIE IPKDELNIRA ATTTSTFDEI HSLAYFSTGN YAYKQQQLLR  240
EDEKSYGLFV PTHYIFTGID DYQHNNQLAS SSNSSYSSFN HDQSLPPNSK ISEYSKNGTR  300
QQLSLNNKSM ISLSQDTGLS SVIPKQGFDS GNHFEDAEDQ DLSVNRCSTI PADLDSIWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-54141759169NAC domain-containing protein 19
3swp_C3e-54141759169NAC domain-containing protein 19
3swp_B3e-54141759169NAC domain-containing protein 19
3swp_A3e-54141759169NAC domain-containing protein 19
3swm_D3e-54141759169NAC domain-containing protein 19
3swm_C3e-54141759169NAC domain-containing protein 19
3swm_B3e-54141759169NAC domain-containing protein 19
3swm_A3e-54141759169NAC domain-containing protein 19
4dul_B3e-54141756166NAC domain-containing protein 19
4dul_A3e-54141756166NAC domain-containing protein 19
1ut7_B3e-54141756166NO APICAL MERISTEM PROTEIN
1ut7_A3e-54141756166NO APICAL MERISTEM PROTEIN
1ut4_B3e-54141756166NO APICAL MERISTEM PROTEIN
1ut4_A3e-54141756166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5102141e-159AF510214.1 Petunia x hybrida nam-like protein 17 (NH17) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587307.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_016471991.10.0PREDICTED: NAC domain-containing protein 79-like
TrEMBLQ8LKN71e-160Q8LKN7_PETHY; Nam-like protein 17 (Fragment)
STRINGVIT_08s0007g07640.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.21e-97Arabidopsis NAC domain containing protein 87